DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and YOX1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:58/244 - (23%)
Similarity:100/244 - (40%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SSVAAAAAAAAAAASSSFAIP----------TSKMYPYVS--NHPSS------HGGLSGMAGFTG 283
            ||:.:....:::..|.||..|          |.|:.|..:  |.|.|      |       ..|.
Yeast    12 SSLLSGTEISSSPVSPSFTNPRTSFHLDDRGTIKLPPLNTSINRPRSVESALRH-------TVTS 69

  Fly   284 LEDKSCSRYTDTVMNSYQSMSVPASA--SAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQ 346
            |.:.| |.|.|.::...||.|..:|.  |:|......|.....:.:::.... ..|.|..|....
Yeast    70 LHENS-SAYGDDMLKHTQSDSALSSQLNSSQETVDESHENLLLTPLNSKKRD-YSVSSKKNDILT 132

  Fly   347 PASG----VMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTR 407
            |.|.    ::|.|........|      ::|.:.   ..|.:......|.|  ..||:.|:|.::
Yeast   133 PLSAAKSIIIPSASKEKRRAFA------FITHSQ---ETFPKKEPKIDNAP--LARRKRRRTSSQ 186

  Fly   408 FQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            ..:: |:.||......::.:|||:|.:..:||:.::|||||:|..:|::
Yeast   187 ELSI-LQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 17/51 (33%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.