DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and ATHB-15

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_849795.1 Gene:ATHB-15 / 841645 AraportID:AT1G52150 Length:837 Species:Arabidopsis thaliana


Alignment Length:160 Identity:40/160 - (25%)
Similarity:61/160 - (38%) Gaps:42/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 CGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALC-----LTERQIKIWF 446
            |.|  |..||........||..|...||:.:|.....:..||.::... |     :..:|||:||
plant     5 CKD--GKLGCLDNGKYVRYTPEQVEALERLYHDCPKPSSIRRQQLIRE-CPILSNIEPKQIKVWF 66

  Fly   447 QNRRM--KLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQ- 508
            ||||.  |.:||...::.:|          .|:.|...: ..::|.::|:|..|...:....:| 
plant    67 QNRRCREKQRKEASRLQAVN----------RKLTAMNKL-LMEENDRLQKQVSQLVHENSYFRQH 120

  Fly   509 --------------------QHQQQQQQPQ 518
                                |||...|.||
plant   121 TPNPSLPAKDTSCESVVTSGQHQLASQNPQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 19/58 (33%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
ATHB-15NP_849795.1 Homeobox 17..74 CDD:278475 18/57 (32%)
bZIP <69..108 CDD:269834 11/49 (22%)
START_ArGLABRA2_like 155..371 CDD:176884
MEKHLA 693..832 CDD:285833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.