DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and PHV

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_174337.1 Gene:PHV / 839928 AraportID:AT1G30490 Length:841 Species:Arabidopsis thaliana


Alignment Length:195 Identity:49/195 - (25%)
Similarity:71/195 - (36%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 YTRFQTLELEK---EFHFNHYLTRRRRIEIAHALCLTE-RQIKIWFQNRRM--KLKKELRAVKEI 463
            ||..|...||:   |......|.|::.|.....||..| ||||:||||||.  |.:||...::.:
plant    25 YTPEQVEALERVYAECPKPSSLRRQQLIRECPILCNIEPRQIKVWFQNRRCREKQRKESARLQTV 89

  Fly   464 NEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQ-----------------------------Q 499
            |          .|:.|...: ..::|.::|:|...                             .
plant    90 N----------RKLSAMNKL-LMEENDRLQKQVSNLVYENGFMKHRIHTASGTTTDNSCESVVVS 143

  Fly   500 QQQQQQQQQQHQQQQQQPQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVG-----GIGPG 559
            .||:|||...||..|:.        .:||.:|  ..:.:..|...|....|..|.     |:.||
plant   144 GQQRQQQNPTHQHPQRD--------VNNPANL--LSIAEETLAEFLCKATGTAVDWVQMIGMKPG 198

  Fly   560  559
            plant   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/54 (43%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
PHVNP_174337.1 Homeobox 21..78 CDD:278475 22/52 (42%)
bZIP <73..112 CDD:269834 11/49 (22%)
START_ArGLABRA2_like 164..380 CDD:176884 9/37 (24%)
MEKHLA 693..836 CDD:285833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.