DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AtHB23

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:149 Identity:44/149 - (29%)
Similarity:70/149 - (46%) Gaps:29/149 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LTDWMG-----SPFERV--VCG-DFNG-----PNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTR 425
            |.|:.|     ||...|  .|. |.||     .:|......::.....|...|||:|...:.|..
plant    31 LQDFHGFLGKRSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKRRLNMEQLKALEKDFELGNKLES 95

  Fly   426 RRRIEIAHALCLTERQIKIWFQNRRMK------------LKKELRAVKEINE--QARRDREEQEK 476
            .|::|:|.||.|..|||.|||||||.:            ||::..::::.||  |.:..:.:.:.
plant    96 DRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQV 160

  Fly   477 M--KAQETMKSAQQNKQVQ 493
            |  |::|.::|...||:.:
plant   161 MALKSREPIESINLNKETE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/63 (35%)
Abdominal-A 456..478 CDD:289192 4/25 (16%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 22/52 (42%)
HALZ 126..168 CDD:396657 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.