DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HDG2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001184911.1 Gene:HDG2 / 839256 AraportID:AT1G05230 Length:721 Species:Arabidopsis thaliana


Alignment Length:212 Identity:41/212 - (19%)
Similarity:84/212 - (39%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 PNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLK--- 454
            ||   :::....:|:.|..|:|..|....:...::|.:::..|.|...|:|.||||:|.::|   
plant    62 PN---KKKRYHRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELNLEPLQVKFWFQNKRTQMKNHH 123

  Fly   455 -----KELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQ 514
                 ..|||.   ||:.|.|.....:..|..:..:......:.:....:.|.:.:..:..::..
plant   124 ERHENSHLRAE---NEKLRNDNLRYREALANASCPNCGGPTAIGEMSFDEHQLRLENARLREEID 185

  Fly   515 Q----------QPQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVGGIGPGIGGGLGGNLG 569
            :          :|..::.:::..|       :....|:|.:|            .|||...||  
plant   186 RISAIAAKYVGKPVSNYPLMSPPP-------LPPRPLELAMG------------NIGGEAYGN-- 229

  Fly   570 MMSALDKSNHDLLKAVS 586
                   :.:||||:::
plant   230 -------NPNDLLKSIT 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 15/51 (29%)
Abdominal-A 456..478 CDD:289192 7/21 (33%)
HDG2NP_001184911.1 Homeobox 67..121 CDD:395001 15/53 (28%)
START_ArGLABRA2_like 246..464 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.