DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HB53

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:121 Identity:29/121 - (23%)
Similarity:56/121 - (46%) Gaps:9/121 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ 466
            ::..|..|...||..|...|.|...|:.:||..|.|..||:.:||||||.:.|.     |::.|:
plant    72 KRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKN-----KKLEEE 131

  Fly   467 ARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHS 522
            ..:.:...:.:    .:...|...|:.:..:|..:.|.:.::..::.::.|.:..|
plant   132 YAKLKNHHDNV----VLGQCQLESQILKLTEQLSEAQSEIRKLSERLEEMPTNSSS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 20/51 (39%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
HB53NP_201471.1 Homeobox 75..125 CDD:395001 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.