DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and REV

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_200877.1 Gene:REV / 836190 AraportID:AT5G60690 Length:842 Species:Arabidopsis thaliana


Alignment Length:208 Identity:50/208 - (24%)
Similarity:82/208 - (39%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 YTRFQTLELEK---EFHFNHYLTRRRRIEIAHALCLTE-RQIKIWFQNRRMKLKKELRAVKEINE 465
            ||..|...||:   |......|.|::.|.....|...| :|||:||||||.              
plant    29 YTAEQVEALERVYAECPKPSSLRRQQLIRECSILANIEPKQIKVWFQNRRC-------------- 79

  Fly   466 QARRDREEQEKMKAQE-TMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQ------------- 516
               ||::.:|..:.|. ..|.:..||.:.::..:.|:|..|...::...:||             
plant    80 ---RDKQRKEASRLQSVNRKLSAMNKLLMEENDRLQKQVSQLVCENGYMKQQLTTVVNDPSCESV 141

  Fly   517 ---PQDHHSI-IAHNPGHLHHSVVGQNDLKLGLGMGVGVGVGGIG-PGIGGGLGGNLGMMSALDK 576
               ||  ||: .|::|..|  ..:.:..|...|....|..|..:. ||:..| ..::|:.:...:
plant   142 VTTPQ--HSLRDANSPAGL--LSIAEETLAEFLSKATGTAVDWVQMPGMKPG-PDSVGIFAISQR 201

  Fly   577 SNHDLLKAVSKVN 589
            .|....:|...|:
plant   202 CNGVAARACGLVS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 20/52 (38%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
REVNP_200877.1 Homeobox 25..83 CDD:365835 22/70 (31%)
bZIP <77..116 CDD:269834 11/55 (20%)
START_ArGLABRA2_like 155..371 CDD:176884 13/63 (21%)
MEKHLA 693..841 CDD:378025
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.