DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HDG7

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001332093.1 Gene:HDG7 / 835293 AraportID:AT5G52170 Length:687 Species:Arabidopsis thaliana


Alignment Length:213 Identity:50/213 - (23%)
Similarity:89/213 - (41%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GDFNGPNGCPRRRGRQT----YTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQN 448
            ||.:.....|:::.|:|    :|.:|..|||..|....:...::|:|:...|.|..:|||.||||
plant    43 GDEDKQEQRPKKKKRKTKYHRHTSYQIQELESFFKECPHPNEKQRLELGKKLTLESKQIKFWFQN 107

  Fly   449 RRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQ-------------QQQ 500
            ||.::|.:|            :|.|...:| ||..|...:|..:::..:             .:.
plant   108 RRTQMKTQL------------ERHENVILK-QENEKLRLENSFLKESMRGSLCIDCGGAVIPGEV 159

  Fly   501 QQQQQQQQQHQQQQQQPQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVGGIGPGIGGGLG 565
            ..:|.|.:....:.::..|....:|      :..:.|...|:.....|:|.....||..:.||. 
plant   160 SFEQHQLRIENAKLKEELDRICALA------NRFIGGSISLEQPSNGGIGSQHLPIGHCVSGGT- 217

  Fly   566 GNLGMMSALDKSNHDLLK 583
             :|..|....::..:|||
plant   218 -SLMFMDLAMEAMDELLK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/55 (38%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
HDG7NP_001332093.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.