DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HAT2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:169 Identity:40/169 - (23%)
Similarity:74/169 - (43%) Gaps:32/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 GVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVV--CGDFNG-----P 393
            ||.|..:..:...||......|..|.|:..             |...:.:.  .|...|     .
plant    71 GVSSPNSTISSTISGKRSEREGISGTGVGS-------------GDDHDEITPDRGYSRGTSDEEE 122

  Fly   394 NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE-- 456
            :|....|.:...::.|:..||:.|..::.|..::::.:|..|.||.||:::||||||.:.|.:  
plant   123 DGGETSRKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQT 187

  Fly   457 -------LRAVKEINEQARRDREEQEKMKAQETMKSAQQ 488
                   .|.|:::.|:.||.::|..:::   |:|.:.|
plant   188 EVDCEYLKRCVEKLTEENRRLQKEAMELR---TLKLSPQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 17/51 (33%)
Abdominal-A 456..478 CDD:289192 6/30 (20%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 5/19 (26%)
HOX 129..183 CDD:197696 18/53 (34%)
HALZ 185..228 CDD:128634 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.