DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HB-7

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001318750.1 Gene:HB-7 / 834733 AraportID:AT5G46880 Length:826 Species:Arabidopsis thaliana


Alignment Length:142 Identity:38/142 - (26%)
Similarity:67/142 - (47%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 AGGAGGAGI--ADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEF 417
            |||:.|:|.  |:.|::         |:..:.....|...|....::|..: :|..|..|:|..|
plant    76 AGGSFGSGSEQAEDPKF---------GNESDVNELHDDEQPPPAKKKRYHR-HTNRQIQEMEALF 130

  Fly   418 HFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQ-E 481
            ..|.:...::|..::..|.|..||:|.||||||.::|            |::||.|...::|: :
plant   131 KENPHPDDKQRKRLSAELGLKPRQVKFWFQNRRTQMK------------AQQDRNENVMLRAEND 183

  Fly   482 TMKSAQQNKQVQ 493
            .:||...:.|.:
plant   184 NLKSENCHLQAE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 18/51 (35%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
HB-7NP_001318750.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.