DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HAT14

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:309 Identity:63/309 - (20%)
Similarity:113/309 - (36%) Gaps:70/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 NSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTS 259
            ||:..:.|.|.:.::........:|:....|..|.|:|:|.:........|..|..|..|.:.:|
plant    21 NSKINNPSVSSTSTSEKDLGFCMALDVAFGGHRSLSSSSSPSVEDEKKKPAPRAKKSDEFRVSSS 85

  Fly   260 KMYP----------YVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSV--PASASAQ 312
            ...|          ...|.....||...:...|.:|::      :....:..||||  |.|.::.
plant    86 VDPPLQLQLHFPNWLPENSKGRQGGRMPLGAATVVEEE------EEEEEAVPSMSVSPPDSVTSS 144

  Fly   313 FAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDW 377
            |...:                  |:.|.|..                       .|.....:.|.
plant   145 FQLDF------------------GIKSYGYE-----------------------RRSNKRDIDDE 168

  Fly   378 MGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQI 442
            :.....|....|.:..||..|::.|  .::.|:..||..|..:..|..:::|.:|..|.|..||:
plant   169 VERSASRASNEDNDDENGSTRKKLR--LSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQV 231

  Fly   443 KIWFQNRRMKLKKE---------LRAVKEINEQARRDREEQEKMKAQET 482
            ::||||||.:.|.:         .|..:.:.|:.||.::|.::::..:|
plant   232 EVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 18/51 (35%)
Abdominal-A 456..478 CDD:289192 5/30 (17%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 19/57 (33%)
HALZ 245..288 CDD:128634 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.