DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HDG4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_193506.2 Gene:HDG4 / 827492 AraportID:AT4G17710 Length:709 Species:Arabidopsis thaliana


Alignment Length:144 Identity:37/144 - (25%)
Similarity:64/144 - (44%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 SGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLEL 413
            |.:..|:|.:.|:|                ..|.|.... :...|....:|..|.|.::.|  ::
plant    58 SKIESGSGKSTGSG----------------HDPVENTAI-EQEPPAAKKKRYHRHTASQIQ--QM 103

  Fly   414 EKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMK 478
            |..|..|.:...:.|:.::..|.|:..|:|.||||:|.::|            |::.|.:..|:|
plant   104 EALFKENAHPDTKTRLRLSKKLGLSPIQVKFWFQNKRTQIK------------AQQSRSDNAKLK 156

  Fly   479 AQ-ETMKSAQQNKQ 491
            |: ||:|:..||.|
plant   157 AENETLKTESQNIQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/51 (31%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
HDG4NP_193506.2 MRP-L20 24..147 CDD:289585 27/119 (23%)
Homeobox 91..144 CDD:278475 17/54 (31%)
MreC 105..>197 CDD:302802 24/78 (31%)
START_ArGLABRA2_like 233..462 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.