DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HB-2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:236 Identity:55/236 - (23%)
Similarity:89/236 - (37%) Gaps:59/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KMYPYVSNHPSSHG-GL----SGMAGFTGL--EDKSCSRYTDTVMNSYQSMSVPASASAQFAQFY 317
            |..|.||..|||.. ||    |....||..  ...|..:.|.|.:........|::|.      |
plant    24 KSNPSVSVTPSSSSFGLFRRSSWNESFTSSVPNSDSSQKETRTFIRGIDVNRPPSTAE------Y 82

  Fly   318 QHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPF 382
            ....|..|:.::..:.:.|..|.....|.|          .|..||:|                 
plant    83 GDEDAGVSSPNSTVSSSTGKRSEREEDTDP----------QGSRGISD----------------- 120

  Fly   383 ERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQ 447
                  |.:|.|.    |.:...::.|:..||:.|..:..|..:::..:|..|.|..||:::|||
plant   121 ------DEDGDNS----RKKLRLSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQ 175

  Fly   448 NRRMKLKKE---------LRAVKEINEQARRDREEQEKMKA 479
            |||.:.|.:         .|..:.:.|:.||.::|..:::|
plant   176 NRRARTKLKQTEVDCEFLRRCCENLTEENRRLQKEVTELRA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/51 (31%)
Abdominal-A 456..478 CDD:289192 5/30 (17%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474 22/88 (25%)
HOX 128..182 CDD:197696 17/53 (32%)
HALZ 184..227 CDD:128634 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.