DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HB4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:402 Identity:85/402 - (21%)
Similarity:122/402 - (30%) Gaps:174/402 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSL 155
            |:||.|:......|..|...|.:..||||.|                 ||:|:|....|      
plant    10 LSLSLGNSQQKEPSLRLNLMPLTTSSSSSSF-----------------QHMHNQNNNSH------ 51

  Fly   156 SAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSA-GNSQAGDSSCSPSPSASGSSSLHRSL 219
                  .|:.|:|         |..|..|...:...:| .||.||              |..|..
plant    52 ------PQKIHNI---------SWTHLFQSSGIKRTTAERNSDAG--------------SFLRGF 87

  Fly   220 NDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPS---SHGGLSGMAGF 281
            |.|           .|.||||.......||..||   |.|.:.....|...   :.||....|  
plant    88 NVN-----------RAQSSVAVVDLEEEAAVVSS---PNSAVSSLSGNKRDLAVARGGDENEA-- 136

  Fly   282 TGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQ 346
               |..||||                                                       
plant   137 ---ERASCSR------------------------------------------------------- 143

  Fly   347 PASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTL 411
                    .||:||:                          .|.:|.||...|: :...::.|.|
plant   144 --------GGGSGGS--------------------------DDEDGGNGDGSRK-KLRLSKDQAL 173

  Fly   412 ELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE---------LRAVKEINEQA 467
            .||:.|..:..|..::::.:|..|.|..||:::||||||.:.|.:         .|....:.|:.
plant   174 VLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEEN 238

  Fly   468 RRDREEQEKMKA 479
            ||.::|..:::|
plant   239 RRLQKEVSELRA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 17/51 (33%)
Abdominal-A 456..478 CDD:289192 5/30 (17%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:398351 44/179 (25%)
Homeobox 166..216 CDD:395001 17/49 (35%)
HALZ 218..261 CDD:128634 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.