DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and PHB

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_181018.1 Gene:PHB / 818036 AraportID:AT2G34710 Length:852 Species:Arabidopsis thaliana


Alignment Length:178 Identity:48/178 - (26%)
Similarity:70/178 - (39%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 YTRFQTLELEK---EFHFNHYLTRRRRIEIAHALCLTE-RQIKIWFQNRRMKLKKELRAV----- 460
            ||..|...||:   |......|.|::.|.....|...| :|||:||||||.:.|:...|.     
plant    29 YTPEQVEALERVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEAARLQTV 93

  Fly   461 -KEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQ--------QQHQQQQQQ 516
             :::|...:...||.::::.| ......:|..::.|............        ||||||...
plant    94 NRKLNAMNKLLMEENDRLQKQ-VSNLVYENGHMKHQLHTASGTTTDNSCESVVVSGQQHQQQNPN 157

  Fly   517 PQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVG-----GIGPG 559
            || |....|:||..|  ..:.:..|...|....|..|.     |:.||
plant   158 PQ-HQQRDANNPAGL--LSIAEEALAEFLSKATGTAVDWVQMIGMKPG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 20/52 (38%)
Abdominal-A 456..478 CDD:289192 4/27 (15%)
PHBNP_181018.1 Homeobox 25..83 CDD:395001 20/53 (38%)
bZIP <77..116 CDD:269834 8/39 (21%)
START_ArGLABRA2_like 168..384 CDD:176884 9/37 (24%)
MEKHLA 707..851 CDD:400830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.