DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HDG3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_180796.2 Gene:HDG3 / 817798 AraportID:AT2G32370 Length:725 Species:Arabidopsis thaliana


Alignment Length:206 Identity:40/206 - (19%)
Similarity:65/206 - (31%) Gaps:74/206 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLS---GGSLSPSHLSQHLGQSPHSPVS 116
            :.:.|||::|...|::.:|..|.|......|.|.|:.|..   |.:.:|.|..:...:.....:|
plant    17 NDNENNNNNNNNGGTDNTNAGNDSGDQDFDSGNTSSGNHGEGLGNNQAPRHKKKKYNRHTQLQIS 81

  Fly   117 SSSPFQQH--HPQVQQ------------------------QHLNHQQQ----------QHLHHQQ 145
            ....|.:.  ||..:|                        |:.|.|::          .||..:.
plant    82 EMEAFFRECPHPDDKQRYDLSAQLGLDPVQIKFWFQNKRTQNKNQQERFENSELRNLNNHLRSEN 146

  Fly   146 QQ------------------------HHHQYSSLSAAL-----QLQQQQHHISKLAAAAVASHGH 181
            |:                        ..|....|:|.|     ||......||:|....|.||..
plant   147 QRLREAIHQALCPKCGGQTAIGEMTFEEHHLRILNARLTEEIKQLSVTAEKISRLTGIPVRSHPR 211

  Fly   182 AHQQLLLTPPS 192
                  ::||:
plant   212 ------VSPPN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
HDG3NP_180796.2 Homeobox 71..125 CDD:395001 6/53 (11%)
START_ArGLABRA2_like 247..471 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.