DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HB17

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:141 Identity:44/141 - (31%)
Similarity:63/141 - (44%) Gaps:22/141 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 GAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFH 418
            |:||.......|:.|.|  :..|.....|..   .|.:.|   ||::.|  .||.|:..||..|.
plant   102 GSGGGRDQLRLDMNRLP--SSEDGDDEEFSH---DDGSAP---PRKKLR--LTREQSRLLEDSFR 156

  Fly   419 FNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMK------------LKKELRAVKEINEQARRDR 471
            .||.|..:::..:|..|.|..|||::||||||.:            ||:...::.|.|.:..|:.
plant   157 QNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREV 221

  Fly   472 EEQEKMKAQET 482
            ||...||...|
plant   222 EELRAMKVGPT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/63 (35%)
Abdominal-A 456..478 CDD:289192 5/21 (24%)
HB17NP_178252.2 HOX 136..192 CDD:197696 25/60 (42%)
HALZ 194..237 CDD:128634 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.