Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571184.2 | Gene: | cdx4 / 798281 | ZFINID: | ZDB-GENE-980526-330 | Length: | 270 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 72/223 - (32%) |
---|---|---|---|
Similarity: | 93/223 - (41%) | Gaps: | 63/223 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 LEDKSCSRYTDTVMNSYQSMSVPAS---ASAQFAQF--YQHATAAASAVSAASAGAIGVD----- 338
Fly 339 ------SLG--NACTQPASGVMPGA--------GGAGGAGIADLP-------------------R 368
Fly 369 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAH 433
Fly 434 ALCLTERQIKIWFQNRRMK----LKKEL 457 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 34/55 (62%) |
Abdominal-A | 456..478 | CDD:289192 | 1/2 (50%) | ||
cdx4 | NP_571184.2 | Caudal_act | 15..138 | CDD:282574 | 28/125 (22%) |
Homeobox | 155..207 | CDD:278475 | 34/51 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |