DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and gsx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:218 Identity:70/218 - (32%)
Similarity:92/218 - (42%) Gaps:70/218 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 MYPYVSNHPSS--HGGLSGMAGFTGLEDKSCSRYTDTVMNSYQS-------MSVPAS-------- 308
            ::|| :.||:.  ||..:|          ||        :|.:|       |.|.||        
 Frog    26 LFPY-AVHPTHPLHGLPAG----------SC--------HSRKSGLLCVCPMCVTASHLHPPPPG 71

  Fly   309 ---ASAQFAQF-YQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRY 369
               ..|.|:.| .|:..|......:||.| |.| |.|.|..|.|                    |
 Frog    72 IPLLKASFSSFGTQYCPAGLGRQHSASTG-INV-SHGPALYQAA--------------------Y 114

  Fly   370 PWMTLTDWMGSPFE-RVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAH 433
            |       :..|.: ..:..|.:.......:|.|..:|..|.||||:||..|.||:|.||||||.
 Frog   115 P-------LPDPRQFHCISVDSSPSQLSSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIAT 172

  Fly   434 ALCLTERQIKIWFQNRRMKLKKE 456
            .|.|:|:|:||||||||:|.|||
 Frog   173 YLNLSEKQVKIWFQNRRVKHKKE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/51 (63%)
Abdominal-A 456..478 CDD:289192 1/1 (100%)
gsx1NP_001039254.1 homeobox 137..196 36/59 (61%)
Homeobox 141..194 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.