DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:234 Identity:92/234 - (39%)
Similarity:112/234 - (47%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 YPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQF----AQFYQHATA 322
            |..:...|:|:|..|       |.||:   ||...... ||.||.|...|.:    :.||.....
  Rat    32 YDALRPFPASYGASS-------LPDKT---YTSPCFYQ-QSNSVLACNRASYEYGASCFYSDKDL 85

  Fly   323 AASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIAD--------LPRYPWMTLTDWMG 379
            :.::.|..|......|.|.   ..|.....|.:....|..:.:        .|.||||       
  Rat    86 SGASPSGNSKQRGPGDYLH---FSPEQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWM------- 140

  Fly   380 SPFERV--VCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQI 442
               :|:  ..|...|.:|   |||||||||:||||||||||||.|||||||||||:|||||||||
  Rat   141 ---QRMNSCAGAVYGSHG---RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQI 199

  Fly   443 KIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQE 481
            ||||||||||.|||.:.:.......     |..:.||.|
  Rat   200 KIWFQNRRMKWKKENKLINSTQASG-----EDSEAKAGE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 48/51 (94%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.