DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Nkx6-3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:209 Identity:58/209 - (27%)
Similarity:82/209 - (39%) Gaps:56/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 MAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGN 342
            :|.|:.::...| :|  :|.||:..:| |.....|.|....|..               .|.|..
  Rat    16 LAQFSEMKAPMC-QY--SVQNSFYKLS-PPGLGPQLAAGTPHGI---------------TDILSR 61

  Fly   343 ACTQPASGVM------PGAGGAGGAGIADLPR----------YP------WM-TLTDWMGS--PF 382
            ....|.|.::      .|.||....|:...|:          ||      |. |..||.||  | 
  Rat    62 PVATPNSSLLSGYPHVAGFGGLSSQGVYYGPQVGSFSKTGNEYPTRTRNCWADTGQDWRGSTRP- 125

  Fly   383 ERVVCGDFNGPNGC-----PRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQI 442
                |.  |.|:..     .::..|.|:|..|...|||.|....||....|..:|::|.:||.|:
  Rat   126 ----CS--NTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQV 184

  Fly   443 KIWFQNRRMKLKKE 456
            |:||||||.|.:|:
  Rat   185 KVWFQNRRTKWRKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.