DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and LHX5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_071758.1 Gene:LHX5 / 64211 HGNCID:14216 Length:402 Species:Homo sapiens


Alignment Length:145 Identity:40/145 - (27%)
Similarity:56/145 - (38%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 NGCPRRRGRQTYTRFQTLE-LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLK--K 455
            |...:|||.:|..:.:.|| |:..|......||..|.::|....|..|.|::||||||.|.:  |
Human   175 NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMK 239

  Fly   456 ELRAV----KEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQH--QQQQ 514
            :|.|:    .......||.|....::...|.:.|.........|..............|  ..|.
Human   240 QLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGPPSQA 304

  Fly   515 QQPQDHHSIIAHNPG 529
            |.|.|...:.|..||
Human   305 QSPADSSFLAASGPG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 19/52 (37%)
Abdominal-A 456..478 CDD:289192 5/25 (20%)
LHX5NP_071758.1 LIM1_Lhx1_Lhx5 5..56 CDD:188753
LIM2_Lhx1_Lhx5 64..119 CDD:188761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..186 4/10 (40%)
Homeobox 183..237 CDD:395001 19/53 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..402 8/22 (36%)
PHA03378 <301..>392 CDD:223065 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.