DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and ceh-63

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001123094.1 Gene:ceh-63 / 6418830 WormBaseID:WBGene00045215 Length:152 Species:Caenorhabditis elegans


Alignment Length:152 Identity:41/152 - (26%)
Similarity:60/152 - (39%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 PNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKEL 457
            |....|...|.|:|..|...||.||..|.|:.:.||.|:|..:.|||.|:|.||||||.|     
 Worm    36 PKRSNRPTKRTTFTSEQVTLLELEFAKNEYICKDRRGELAQTIELTECQVKTWFQNRRTK----- 95

  Fly   458 RAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHS 522
                              |.:....::     |.:.::..::....|....||.|..|       
 Worm    96 ------------------KRRCTSPLR-----KSMMKKSDERSPSPQNPSSQHVQNLQ------- 130

  Fly   523 IIAHN-PGHLHHSVVG--QNDL 541
            ...|: |.|..:|:..  ||::
 Worm   131 TFFHSWPSHFAYSLPSDQQNNV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 26/51 (51%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
ceh-63NP_001123094.1 Homeobox 44..98 CDD:365835 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.