DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and gfod2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001025591.1 Gene:gfod2 / 594979 XenbaseID:XB-GENE-5740207 Length:384 Species:Xenopus tropicalis


Alignment Length:39 Identity:10/39 - (25%)
Similarity:18/39 - (46%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 DREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQ 508
            |..:.||:.....|..|...|.::|..|.|:.::...|:
 Frog   292 DISDFEKVPPPYLMGIAHMVKALRQSFQDQEDRRTWDQK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192 3/7 (43%)
gfod2NP_001025591.1 MviM 1..365 CDD:223745 10/39 (26%)
GFO_IDH_MocA 7..118 CDD:279716
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.