DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxa5a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:268 Identity:88/268 - (32%)
Similarity:124/268 - (46%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ASGSSSLHRSLNDNSPGS--ASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYP--YVSNHP 269
            |.|.:.:..|...:|||.  :|...:.|...|..|.........::|.|.|:|...|  .::|.|
Zfish     7 ACGYNGMDLSTGHSSPGHFLSSGERTQSYKDSPTATPVRYNQPVTASSAEPSSDHLPCSSLANSP 71

  Fly   270 SSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGA 334
            .|.                         .|::::.:..|::|..|              :.|.|.
Zfish    72 VSE-------------------------QSHRALKISLSSTAGSA--------------SKSFGT 97

  Fly   335 I----GVDSLGNACTQPASGVMPGAGGAGGAGIADLPR-YPWMTLTDWMGSPFERVVCGDFNGPN 394
            :    ||..:.::..:...   ||:|......:::.|: ||||...        .:...:..||.
Zfish    98 VLSREGVSKVSSSMEEEKP---PGSGQTASQNVSEAPQIYPWMRKL--------HISHDNLAGPE 151

  Fly   395 GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459
            |   :|.|..|||:||||||||||||.||||||||||||.|||:||||||||||||||.||: ..
Zfish   152 G---KRPRTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD-NK 212

  Fly   460 VKEINEQA 467
            :|.:|..|
Zfish   213 LKSMNMAA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 45/51 (88%)
Abdominal-A 456..478 CDD:289192 3/12 (25%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.