DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxb6b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:238 Identity:88/238 - (36%)
Similarity:109/238 - (45%) Gaps:68/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQ 315
            |::|.....:...|.|::....||:.|.:|.|    .:|...|..:                   
Zfish    41 SATFGATNVQDKVYTSSYYQQAGGVFGRSGST----SACDYSTPNI------------------- 82

  Fly   316 FYQHATAAASAVSAASAGAIGVDSLGNACTQ------------PASGVMPGAGGAGGAGIADLPR 368
             |:.|..:.:..|...:..:..|.....||:            |.:                 |.
Zfish    83 -YRSADRSCAIGSLEDSLVLTQDQCKTDCTEQGTERYFSTEDKPCT-----------------PV 129

  Fly   369 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAH 433
            ||||          :|:  ...||..|...||||||||||||||||||||||.||||||||||:|
Zfish   130 YPWM----------QRM--NSCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISH 182

  Fly   434 ALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476
            |||||||||||||||||||.|||.:||   |.....|.|:..|
Zfish   183 ALCLTERQIKIWFQNRRMKWKKENKAV---NSAKVSDEEDGGK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 49/51 (96%)
Abdominal-A 456..478 CDD:289192 7/21 (33%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 4/14 (29%)
Homeobox 151..203 CDD:278475 49/51 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.