DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxa3a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571609.1 Gene:hoxa3a / 58049 ZFINID:ZDB-GENE-000823-3 Length:411 Species:Danio rerio


Alignment Length:359 Identity:81/359 - (22%)
Similarity:118/359 - (32%) Gaps:153/359 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SPVSSSSPFQQ----HHPQVQQQHLNHQQQQHLHHQQQQHHH----QYSSLSAALQLQQQQHHIS 169
            |.:.|..|:|.    .:...|||:|     |.||.:.:.|..    |...:||.|....:...:.
Zfish    10 SAIYSGLPYQSANGLGYDASQQQYL-----QALHAESEYHRPACSLQSPGISAGLHTSNEMSEVC 69

  Fly   170 KLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNS--PGSASASAS 232
                          ||:                       :|:.:.....:||.  |.:.|..:|
Zfish    70 --------------QQI-----------------------NGTQATVTDTSDNKQPPTAPSGPSS 97

  Fly   233 ASAASSVAAAAAAAAAAASSSFAIPTSK-MYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTV 296
            .|:.:.:....:||......|....|.| ::|::.....:            .:.||||      
Zfish    98 PSSLNQIPNIDSAAKNPVHVSPTPSTRKHIFPWMKESRQN------------TKQKSCS------ 144

  Fly   297 MNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGA 361
                                                 .|.|:|.......|     ||:..:   
Zfish   145 -------------------------------------IISVESCAGRQKSP-----PGSAAS--- 164

  Fly   362 GIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRR 426
                                                 :|.|..||..|.:|||||||||.||.|.
Zfish   165 -------------------------------------KRARTAYTSAQLVELEKEFHFNRYLCRP 192

  Fly   427 RRIEIAHALCLTERQIKIWFQNRRMKLKKELRAV 460
            ||:|:|:.|.||||||||||||||||.||:.:.:
Zfish   193 RRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 0/5 (0%)
hoxa3aNP_571609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..126 10/46 (22%)
Antp-type hexapeptide 127..132 1/4 (25%)
Homeobox 168..220 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..250 0/4 (0%)
DUF4074 347..409 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.