DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxa9b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571608.1 Gene:hoxa9b / 58048 ZFINID:ZDB-GENE-000823-2 Length:258 Species:Danio rerio


Alignment Length:266 Identity:72/266 - (27%)
Similarity:95/266 - (35%) Gaps:116/266 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 AASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMA------------GFTGLEDK 287
            |.||:..|:.:......:|.|     .:||: :||.|.|...|.:            .||||...
Zfish    55 AKSSIFGASWSPVQPTGASIA-----YHPYI-HHPCSTGDSDGASVRPWALEPLPALPFTGLSTD 113

  Fly   288 S--------------CSRYT-------------------DTVMNSYQSMSVPASASAQFAQFYQH 319
            :              |:.:|                   |.|.|......:||...         
Zfish   114 THQDIKLEPLVGSGECTTHTLLVAETDNNTTQTERKVPDDAVSNGSHDEKIPAETK--------- 169

  Fly   320 ATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFER 384
                             :|...:.|.|                  |.|      |::|:.:...|
Zfish   170 -----------------LDLDPSKCNQ------------------DNP------LSNWLHAKSTR 193

  Fly   385 VVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNR 449
                    ...||       ||:.|||||||||.||.||:|.||.|:|..|.|||||:|||||||
Zfish   194 --------KKRCP-------YTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWFQNR 243

  Fly   450 RMKLKK 455
            |||:||
Zfish   244 RMKMKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 72/266 (27%)
hoxa9bNP_571608.1 Hox9_act 1..174 CDD:282473 25/150 (17%)
Homeobox 195..248 CDD:278475 38/59 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.