Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571608.1 | Gene: | hoxa9b / 58048 | ZFINID: | ZDB-GENE-000823-2 | Length: | 258 | Species: | Danio rerio |
Alignment Length: | 266 | Identity: | 72/266 - (27%) |
---|---|---|---|
Similarity: | 95/266 - (35%) | Gaps: | 116/266 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 235 AASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMA------------GFTGLEDK 287
Fly 288 S--------------CSRYT-------------------DTVMNSYQSMSVPASASAQFAQFYQH 319
Fly 320 ATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFER 384
Fly 385 VVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNR 449
Fly 450 RMKLKK 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 36/51 (71%) |
Abdominal-A | 456..478 | CDD:289192 | 72/266 (27%) | ||
hoxa9b | NP_571608.1 | Hox9_act | 1..174 | CDD:282473 | 25/150 (17%) |
Homeobox | 195..248 | CDD:278475 | 38/59 (64%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |