DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxc6b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_005172831.1 Gene:hoxc6b / 58045 ZFINID:ZDB-GENE-000822-1 Length:228 Species:Danio rerio


Alignment Length:118 Identity:61/118 - (51%)
Similarity:75/118 - (63%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 YPWM-TLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIA 432
            |||| .:....|..:            |..||||||.|:|:||||||||||:|.|||||||||||
Zfish   118 YPWMQRMNSHSGVGY------------GSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIA 170

  Fly   433 HALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ----ARRDREEQEKMKAQE 481
            :.|||:||||||||||||||.|||......:|:.    |.:|.:::|..:..|
Zfish   171 NTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDKEETGETAE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 43/51 (84%)
Abdominal-A 456..478 CDD:289192 5/25 (20%)
hoxc6bXP_005172831.1 Homeobox 140..192 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.