DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxb7a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:253 Identity:90/253 - (35%)
Similarity:121/253 - (47%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 AAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASA 309
            |::|.::..|...||..:...|...|.:|..|                |...::|..|:|:|:  
Zfish    17 ASSAFSTGVFPEQTSCAFSCSSQRASGYGSAS----------------TGAPVSSSSSVSLPS-- 63

  Fly   310 SAQFAQFYQHATAAASAV-----SAASAGAIGVD--------------SLGNACTQPASGVMPGA 355
                  .|.:.|:.:|..     :|...||:.::              |.|:.|...:|| ....
Zfish    64 ------MYTNGTSLSSHTQGMYPTAYELGAVSLNMHSSLFDHPNLPMVSAGDLCKAQSSG-KEEQ 121

  Fly   356 GGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFN 420
            .|.......:|..||||..|                   |..|:||||||:|:||||||||||||
Zfish   122 RGYHQNNENNLRIYPWMRST-------------------GADRKRGRQTYSRYQTLELEKEFHFN 167

  Fly   421 HYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN---EQARRDREEQE 475
            .||:||||||||||||||||||||||||||||.|||.::....:   :|...|.||::
Zfish   168 RYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKSTDRCSPAADQIGGDEEEED 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 47/51 (92%)
Abdominal-A 456..478 CDD:289192 5/23 (22%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 3/4 (75%)
Homeobox 149..201 CDD:278475 47/51 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.