DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and NKX3-2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001180.1 Gene:NKX3-2 / 579 HGNCID:951 Length:333 Species:Homo sapiens


Alignment Length:325 Identity:78/325 - (24%)
Similarity:116/325 - (35%) Gaps:96/325 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAA 244
            |.|...||.:|  ||...|...: :.||....|.|.....|::....|.|          ..|:.
Human    64 GGAEDSLLASP--AGTRTAAGRT-AESPEGWDSDSALSEENESRRRCADA----------RGASG 115

  Fly   245 AAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASA 309
            |..|..|.|...|..:                 :|....||:::..|     .:|..|.||....
Human   116 AGLAGGSLSLGQPVCE-----------------LAASKDLEEEAAGR-----SDSEMSASVSGDR 158

  Fly   310 SAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTL 374
            |.:...  .......:.|||..:||                  .|.||:|.||:|:....|    
Human   159 SPRTED--DGVGPRGAHVSALCSGA------------------GGGGGSGPAGVAEEEEEP---- 199

  Fly   375 TDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTE 439
                .:|..|             ::|.|..::..|..|||:.|:...||:...|.::|.:|.|||
Human   200 ----AAPKPR-------------KKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTE 247

  Fly   440 RQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQ 504
            .|:||||||||.|.|:                    :..|.:.:.||...|:|..:...:..|:|
Human   248 TQVKIWFQNRRYKTKR--------------------RQMAADLLASAPAAKKVAVKVLVRDDQRQ 292

  Fly   505  504
            Human   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 0/21 (0%)
NKX3-2NP_001180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..113 14/60 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..212 25/119 (21%)
Homeobox 209..262 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.