DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and meox2b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001038589.1 Gene:meox2b / 566969 ZFINID:ZDB-GENE-060503-853 Length:289 Species:Danio rerio


Alignment Length:298 Identity:78/298 - (26%)
Similarity:111/298 - (37%) Gaps:87/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 CSPSPSASGSSSLH----RSLNDNS--------PGSASASASASAASSVAAAAAAAAAAASSSFA 255
            |..:|.|. |.:||    ::|:..|        ||.:...:.|...||...|......|      
Zfish     8 CLRNPHAP-SQALHPAFTQALHGRSDHISYPDLPGPSPPCSYAGEESSFGGAHHRVHPA------ 65

  Fly   256 IPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHA 320
                   |...:||..|                          .:....:|:..|.:......|.
Zfish    66 -------PQHPHHPQHH--------------------------QWHVPQMPSIESERHGLCLPHP 97

  Fly   321 TAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLP-RYPWMTLTDWMGSPFE- 383
            .|||..:....||:.|: ..||          |...|:..:|::.:| .|....:     ||.| 
Zfish    98 DAAAPELCGTGAGSQGM-CAGN----------PTLTGSDPSGVSCVPGEYGRQNM-----SPVEP 146

  Fly   384 ------------RVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALC 436
                        ....|.:........|:.|..:|:.|..|||.||..::||||.||.|||..|.
Zfish   147 ERRSSKGKSDSSDSQDGSYKSDVSSKPRKERTAFTKEQIRELESEFAHHNYLTRLRRYEIAVNLD 211

  Fly   437 LTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQ 474
            |||||:|:||||||||.|:    ||. .:|....||::
Zfish   212 LTERQVKVWFQNRRMKWKR----VKG-GQQGAAAREKE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/51 (63%)
Abdominal-A 456..478 CDD:289192 5/19 (26%)
meox2bNP_001038589.1 Homeobox 177..229 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.