DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP004648

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_001688961.2 Gene:AgaP_AGAP004648 / 5667717 VectorBaseID:AGAP004648 Length:789 Species:Anopheles gambiae


Alignment Length:275 Identity:80/275 - (29%)
Similarity:118/275 - (42%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTD---- 294
            |.:.::.:.....|....|...|..::.....:|. .....::|.....|.:...|.:.|.    
Mosquito    17 SESPAIGSLHVGTAVVVGSETDITNAQQVSLTTNQ-QQQTIIAGSTQLIGRKQVICDKTTRVATQ 80

  Fly   295 -TVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG-----VDSLGNACTQPASGVMP 353
             :|:.|.:.:.  |.|:.|.....|...|..|......:|.|.     .:.|.:..::....|..
Mosquito    81 LSVITSVEPLG--AQAATQQQPHQQQRIADTSYWMQNESGFINSQPSMAEFLTHIDSESPKLVTQ 143

  Fly   354 GAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVC------GDFNGPNGCPRRRGRQTYTRFQTLE 412
            |........:..:|.||||.         |:...      .:|...||.|||. |..||..|.||
Mosquito   144 GIPIGPSDNMESVPEYPWMK---------EKKTARKATAQAEFVAENGLPRRL-RTAYTNTQLLE 198

  Fly   413 LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRD-REEQEK 476
            ||||||||.||.|.||||||.:|.|||||:|:||||||||.|::..:..:.:|..:.| :.|.|:
Mosquito   199 LEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDDESGKDDLKGEHEQ 263

  Fly   477 M----KAQETMKSAQ 487
            :    ....:.||.|
Mosquito   264 LIGIVSDSNSKKSCQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 38/51 (75%)
Abdominal-A 456..478 CDD:289192 4/26 (15%)
AgaP_AGAP004648XP_001688961.2 Homeobox 188..240 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.