DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP005041

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_001688472.1 Gene:AgaP_AGAP005041 / 5667286 VectorBaseID:AGAP005041 Length:263 Species:Anopheles gambiae


Alignment Length:201 Identity:60/201 - (29%)
Similarity:85/201 - (42%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEI 463
            ||.|..:|..|.|||||:|..:.||:|.:|.|:|:.|.|:|.|:||||||||||.|:.    :::
Mosquito    13 RRPRTAFTSQQLLELEKQFKVSKYLSRPKRYEVANNLLLSETQVKIWFQNRRMKWKRS----RKV 73

  Fly   464 NEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSIIAHNP 528
            ||         .|..:..:..|...|....................:   ......:.:|..|:.
Mosquito    74 NE---------SKKYSNNSNNSGSNNNNTTTTNSSSSSSSSSNSSTN---GSSTGSNSNISNHSN 126

  Fly   529 GHLHHSVVGQNDLKLGLGMGVGVGVGGIGPGIG--------GGLGGNLGMMSALD--KSNHDLLK 583
            |.|..|.|  |....|.|.|     |.:..|.|        |..||.....||.|  :::|....
Mosquito   127 GPLGSSNV--NSAHNGGGTG-----GSLLHGSGNKTSTDHQGADGGRPFNRSAGDPGRTDHCASG 184

  Fly   584 AVSKVN 589
            .|||::
Mosquito   185 MVSKLS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 29/51 (57%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
AgaP_AGAP005041XP_001688472.1 Homeobox 15..68 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.