DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and barx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001020120.1 Gene:barx1 / 553644 ZFINID:ZDB-GENE-050522-28 Length:248 Species:Danio rerio


Alignment Length:232 Identity:54/232 - (23%)
Similarity:95/232 - (40%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 DKSCSRY----TDTVMNSYQSMSVPASASAQFAQFYQHATAAAS------AVSAASAGAI--GVD 338
            |:...||    .:.::..:....| :|.:....:|..||..:|.      .:.|...|.:  .|.
Zfish    19 DQRSHRYRSFMIEEILTDHPDQKV-SSPTGDLLKFGVHALLSARPYHNHLVLKADQTGILKFPVS 82

  Fly   339 SLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFN-GPNGCPR---- 398
            .|..:...|.|..:  ..||.|..:.....:          .|.:..:.|..: |.:...:    
Zfish    83 PLSCSLGAPLSSAL--LSGAAGLQVGSSSHH----------LPLDLHLRGKLDPGADAVSKTKKG 135

  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEI 463
            ||.|..:|..|.:.|||.|....||:...||::|.:|.|::.|:|.|:||||||.||.:.....:
Zfish   136 RRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGL 200

  Fly   464 NEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQ 500
                    |...|.|.:....|...::|:.:|::.::
Zfish   201 --------ESPTKPKGRPKKNSIPTSEQLSEQERTRE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
barx1NP_001020120.1 Homeobox 138..191 CDD:278475 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..248 6/41 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.