DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and barhl1b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:248 Identity:62/248 - (25%)
Similarity:103/248 - (41%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 AAAASSSFAIPTSKMY----PYVSNHPSSHGGLSGMAGFTGLED--KSCSR----YTDTVMNSYQ 301
            |:...|||.|.:...:    |.:|...|..|.......|:...|  ..||.    ..:.|.::.|
Zfish     3 ASTNGSSFGIDSLLSHRPGSPVISKGDSLVGECRSPLEFSPRSDLESGCSSPPSPRRECVEDAAQ 67

  Fly   302 SMSVPASASAQFAQFYQHATAAASAVSAASAGAIGV-DSLGN-----ACTQPASGVMP-GAGGAG 359
            ....|.:    :|...||...:|.:.....|.:..: |.|.:     ||...:|...| ...|..
Zfish    68 RQGHPLA----YASHLQHGPISAGSQPRTVASSFLIRDILADCKPLAACAPYSSNGQPTQEAGRL 128

  Fly   360 GAGIAD--LPRYPWMTLTDWMGSPFERVVCGD--FNGPNGCPR------RRGRQTYTRFQTLELE 414
            .:.|||  :.:....:.:|   |.::....||  .:.....|:      |:.|..:|..|..:||
Zfish   129 ASKIADDLIEKIHSNSSSD---SEYKVKEEGDREISSSRDSPQVRLKKPRKARTAFTDHQLAQLE 190

  Fly   415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQA 467
            :.|....||:.:.|:|:|.:|.||:.|:|.|:||||.|.|::.....|:..:|
Zfish   191 RSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/51 (43%)
Abdominal-A 456..478 CDD:289192 2/12 (17%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 9/43 (21%)
Homeobox 178..230 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.