Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016082.1 | Gene: | lhx5 / 548836 | XenbaseID: | XB-GENE-490400 | Length: | 402 | Species: | Xenopus tropicalis |
Alignment Length: | 243 | Identity: | 54/243 - (22%) |
---|---|---|---|
Similarity: | 82/243 - (33%) | Gaps: | 70/243 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 NGCPRRRGRQTYTRFQTLE-LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLK--K 455
Fly 456 ELRAV----KEINEQARRDREEQEKMKAQETMKS------------------------AQQNKQV 492
Fly 493 QQQQQQQQQQ------------QQQQQQQHQQQQQQPQDHHSIIAH----NP-----GHLHHSVV 536
Fly 537 GQNDLKLGLGMGVGVGVGGIGPGIGGGLGGNLGMMSALDKSNHDLLKA 584 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 19/52 (37%) |
Abdominal-A | 456..478 | CDD:289192 | 5/25 (20%) | ||
lhx5 | NP_001016082.1 | LIM1_Lhx1_Lhx5 | 5..56 | CDD:188753 | |
LIM2_Lhx1_Lhx5 | 64..119 | CDD:188761 | |||
Homeobox | 183..237 | CDD:365835 | 19/53 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |