DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxb4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001116487.1 Gene:hoxb4 / 548393 XenbaseID:XB-GENE-1033882 Length:234 Species:Xenopus tropicalis


Alignment Length:304 Identity:86/304 - (28%)
Similarity:107/304 - (35%) Gaps:110/304 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSF 254
            ||....|.........||...|......|....:|.|.|.|:|::..:|...:....|....||.
 Frog    18 PPCEEYSHTDYLPSGHSPEYYGGQKRESSFQHGAPYSRSLSSSSAPYTSCQGSVRQGARLPHSSG 82

  Fly   255 AIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQH 319
            .:|..|.:...|..|:|              ..|||                     ..|..::|
 Frog    83 LLPGEKAHLESSITPTS--------------PPSCS---------------------LIASDHKH 112

  Fly   320 ATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWM----------TL 374
            .                 ||.|.                      |...||||          |.
 Frog   113 P-----------------DSPGQ----------------------DPVVYPWMKKAHISRASSTY 138

  Fly   375 TDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTE 439
            :|           |:        .:|.|..|||.|.||||||||:|.|||||||:||||.|.|:|
 Frog   139 SD-----------GE--------AKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLRLSE 184

  Fly   440 RQIKIWFQNRRMKLKKE-------LRAVKEINEQARRDREEQEK 476
            |||||||||||||.||:       :|:...:|.|.......|.|
 Frog   185 RQIKIWFQNRRMKWKKDHKLPNTKIRSNPSVNLQIAGGSPNQNK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 41/51 (80%)
Abdominal-A 456..478 CDD:289192 5/28 (18%)
hoxb4NP_001116487.1 Homeobox 146..200 CDD:365835 41/53 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.