DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment abd-A and PITX1

DIOPT Version :9

Sequence 1:	NP_732176.1	Gene:	abd-A / 42037	FlyBaseID:	FBgn0000014	Length:	590	Species:	Drosophila melanogaster
Sequence 2:	NP_002644.4	Gene:	PITX1 / 5307	HGNCID:	9004	Length:	314	Species:	Homo sapiens

Alignment Length:	115	Identity:	37/115 - (32%)
Similarity:	48/115 - (41%)	Gaps:	30/115 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   353 PGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGP-NGCPRRRGRQTYTRFQTLELEKE 416
            |...||||.|                        ||..:.| ....:||.|..:|..|..|||..
Human    67 PEDSGAGGTG------------------------CGGADDPAKKKKQRRQRTHFTSQQLQELEAT 107

  Fly   417 FHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ 466
            |..|.|.....|.|||....|||.::::||:|||.|.:|     :|.|:|
Human   108 FQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRK-----RERNQQ 152

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	22/51 (43%)
abd-A	NP_732176.1	Abdominal-A	456..478	CDD:289192	3/11 (27%)
PITX1	NP_002644.4	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..103		14/59 (24%)
		COG5576	36..>146	CDD:227863	33/102 (32%)
		Homeobox	93..146	CDD:395001	22/52 (42%)
		Interaction with PIT-1. /evidence=ECO:0000250	147..279		3/6 (50%)
		OAR	276..293	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	280..293
		Nuclear localization signal. /evidence=ECO:0000255	286..290
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910