DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and PITX1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_002644.4 Gene:PITX1 / 5307 HGNCID:9004 Length:314 Species:Homo sapiens


Alignment Length:115 Identity:37/115 - (32%)
Similarity:48/115 - (41%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 PGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGP-NGCPRRRGRQTYTRFQTLELEKE 416
            |...||||.|                        ||..:.| ....:||.|..:|..|..|||..
Human    67 PEDSGAGGTG------------------------CGGADDPAKKKKQRRQRTHFTSQQLQELEAT 107

  Fly   417 FHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ 466
            |..|.|.....|.|||....|||.::::||:|||.|.:|     :|.|:|
Human   108 FQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRK-----RERNQQ 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/51 (43%)
Abdominal-A 456..478 CDD:289192 3/11 (27%)
PITX1NP_002644.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 14/59 (24%)
COG5576 36..>146 CDD:227863 33/102 (32%)
Homeobox 93..146 CDD:395001 22/52 (42%)
Interaction with PIT-1. /evidence=ECO:0000250 147..279 3/6 (50%)
OAR 276..293 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 280..293
Nuclear localization signal. /evidence=ECO:0000255 286..290
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.