DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and PAX6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:404 Identity:76/404 - (18%)
Similarity:129/404 - (31%) Gaps:152/404 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSS-CSPSPSA 209
            |..|.:....|:|.::::.....::|.|.::...|   :..|...||.|:    ||. |:     
Human    31 QSQHAEQGGRSSAAEIKRAVAGANRLPALSLTCGG---RTCLWLKPSPGS----DSHVCT----- 83

  Fly   210 SGSSSLH---------RSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYV 265
            .|.|.::         |.|.|            |....:...|.:.|.....|..:       .|
Human    84 GGHSGVNQLGGVFVNGRPLPD------------STRQKIVELAHSGARPCDISRIL-------QV 129

  Fly   266 SNHPSSHGGLSGMAGFTGLEDKSCSRYTDT-------VMNSYQSMSVPASASAQFAQFYQHATA- 322
            ||               |...|...||.:|       :..|...::.|...| :.||:.:...: 
Human   130 SN---------------GCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVS-KIAQYKRECPSI 178

  Fly   323 ---------------------AASAVS------AASAGAIGVDSLGNACTQPASGVMPGAGGAGG 360
                                 :.|:::      |:....:|.|.:.:...     ::.|..|:.|
Human   179 FAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLR-----MLNGQTGSWG 238

  Fly   361 AGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRG------------------------ 401
            .      |..|...|...|.|.:          :||.::.|                        
Human   239 T------RPGWYPGTSVPGQPTQ----------DGCQQQEGGGENTNSISSNGEDSDEAQMRLQL 287

  Fly   402 -------RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459
                   |.::|:.|...|||||...||.....|..:|..:.|.|.:|::||.|||.|.::|   
Human   288 KRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRRE--- 349

  Fly   460 VKEINEQARRDREE 473
                 |:.|..|.:
Human   350 -----EKLRNQRRQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 4/18 (22%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645 23/158 (15%)
Homeobox 295..348 CDD:395001 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.