DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and PAX3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_852124.1 Gene:PAX3 / 5077 HGNCID:8617 Length:505 Species:Homo sapiens


Alignment Length:144 Identity:39/144 - (27%)
Similarity:56/144 - (38%) Gaps:27/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 RRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKE 462
            :||.|.|:|..|..|||:.|...||.....|.|:|....|||.::::||.|||.:.:|:..|   
Human   219 QRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGA--- 280

  Fly   463 INEQARRDREEQEKM------------KAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQ 515
                       .:.|            .|..|:.:.|.::...|.....|.........|:.|..
Human   281 -----------NQLMAFNHLIPGGFPPTAMPTLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPL 334

  Fly   516 QPQD-HHSIIAHNP 528
            .|.. |.|.|..||
Human   335 PPSTVHQSTIPSNP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 2/33 (6%)
PAX3NP_852124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PAX 34..159 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 37..93
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 113..161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..228 4/8 (50%)
Homeobox 222..276 CDD:395001 21/53 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..351 10/40 (25%)
Pax7 347..391 CDD:403540 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.