DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment abd-A and DUXA

DIOPT Version :9

Sequence 1:	NP_732176.1	Gene:	abd-A / 42037	FlyBaseID:	FBgn0000014	Length:	590	Species:	Drosophila melanogaster
Sequence 2:	NP_001012747.1	Gene:	DUXA / 503835	HGNCID:	32179	Length:	204	Species:	Homo sapiens

Alignment Length:	96	Identity:	31/96 - (32%)
Similarity:	47/96 - (48%)	Gaps:	14/96 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKL----KKELRA 459
            ||.|.||:..|...|.|.|..|.|.....|.|:|..:.:.|.:::|||||||.:|    |:|..|
Human   102 RRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEIGVPESRVQIWFQNRRSRLLLQRKREPVA 166

  Fly   460 VKEINEQARRDREEQEKMKAQETMKSAQQNK 490
                      ..|::|:.|..|.::.|:..:
Human   167 ----------SLEQEEQGKIPEGLQGAEDTQ 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	21/55 (38%)
abd-A	NP_732176.1	Abdominal-A	456..478	CDD:289192	4/21 (19%)
DUXA	NP_001012747.1	homeodomain	16..74	CDD:238039
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	73..101
		Homeobox	105..155	CDD:278475	20/49 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	163..204		7/35 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910