DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Noto

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:317 Identity:72/317 - (22%)
Similarity:105/317 - (33%) Gaps:113/317 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYV 265
            ||..|.|::||:..        .||..   .....|.|.......|.....|||::......|..
  Rat     2 SSPVPQPASSGTQV--------QPGDL---GPCPVAVSPVVPNHLARGRLESSFSVEAILARPET 55

  Fly   266 SNHPSSHGGLSGMAGFTGLEDKSCSRY--------TDTVMNSYQSMSVPASASAQFAQFYQHATA 322
            ..|.::...||..   |.|...|.|:|        |.|.:.:|.|:.:....|.           
  Rat    56 REHSATSLPLSTC---TSLNFGSVSQYQVLPWVCSTGTWLPTYLSVGIYPMCSM----------- 106

  Fly   323 AASAVSAASAGAIGVDSLGNACTQPASGVMPG--------------AGGAGGAGIADLPRYPWMT 373
                                :|       |||              .|....:.:..|.|.|.:.
  Rat   107 --------------------SC-------MPGLNVTHLFCQQGLRLTGSELPSCLGPLKRAPTVN 144

  Fly   374 LTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLT 438
            |.|   ...||            .::|.|..::..|..||||.|...|.|..:.|.::|..|.||
  Rat   145 LQD---HNTER------------HQKRVRTMFSEQQLGELEKVFAKQHNLVGKERAQLAARLHLT 194

  Fly   439 ERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKA------QETMKSAQQN 489
            |.|::|||||||:|.:|                  |:|:|:      :|...|::.|
  Rat   195 ENQVRIWFQNRRVKYQK------------------QQKLKSPPPDAMEEPSNSSEGN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
NotoNP_001178943.1 Homeobox 158..209 CDD:278475 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.