DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Emx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_575584.5 Gene:Emx1 / 500235 RGDID:1564002 Length:290 Species:Rattus norvegicus


Alignment Length:373 Identity:83/373 - (22%)
Similarity:129/373 - (34%) Gaps:122/373 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVA 177
            :|.::::|..:..|:....|                    ||.:||...|            ...
  Rat     7 TPRTAAAPGHRAFPRAPLPH--------------------SSSAAATMFQ------------PAT 39

  Fly   178 SHGHAHQQLLLTPPSAGNSQ-AGDSSCSPSPSASGSSSLH-RSLNDNSPGSASASASASAASSVA 240
            ..|...:.|:......|.|. :|.:...|...|:....|. .:||...|       ||:..:.|:
  Rat    40 KRGFTIESLVAKDGGTGGSPGSGGAGSHPLAVAASEEPLRPTALNYPHP-------SAAETAFVS 97

  Fly   241 AAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSV 305
            ...|||||.||.|.......::|...|||:.                       ||..::|    
  Rat    98 GFPAAAAAGASRSLYGGPELVFPEAMNHPAL-----------------------TVHPAHQ---- 135

  Fly   306 PASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIAD-LPRY 369
                                              ||::..||.....       .|...| |..|
  Rat   136 ----------------------------------LGSSSLQPPHSFF-------SAQHRDPLHFY 159

  Fly   370 PWMTLTDWMGSPFE-RVVCGD---FNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIE 430
            ||:....:.|..|: ..|..|   .:||.....:|.|..::..|.|.||:.|..|||:....|.:
  Rat   160 PWVLRNRFFGHRFQASEVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQ 224

  Fly   431 IAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMK 478
            :|.:|.|:|.|:|:||||||.|.|::     ::.|:.   .|.::|.|
  Rat   225 LAGSLSLSETQVKVWFQNRRTKYKRQ-----KLEEEG---PESEQKKK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
Emx1XP_575584.5 COG5576 141..>251 CDD:227863 39/121 (32%)
Homeobox 196..248 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.