DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Lbx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001102714.1 Gene:Lbx2 / 500224 RGDID:1561172 Length:196 Species:Rattus norvegicus


Alignment Length:150 Identity:49/150 - (32%)
Similarity:62/150 - (41%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 DSLGNACT--QPASGVMPGAGGAGGAGIADL------------PRYPWMTLTDWMGSPFE-RVVC 387
            |.||.:..  .|:...:|.||....:.:..|            ||.|         .|.| |.|.
  Rat    15 DILGRSMVPGAPSEPRLPEAGPDPASPLCALEELASKTFQGHSPRAP---------QPSEGRAVP 70

  Fly   388 GDFNGP-NGCPRRR-GRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 450
            ....|| .|..||| .|..:|..|.||||:.|.|..||....|..:|..|.|...|:..||||||
  Rat    71 EAPPGPGTGVRRRRKSRTAFTPQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRR 135

  Fly   451 MKLKKELRAVKEINEQARRD 470
            .|||:::       |:.|.|
  Rat   136 AKLKRDV-------EEMRAD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 2/14 (14%)
Lbx2NP_001102714.1 Homeobox 86..139 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.