DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Emx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001102639.1 Gene:Emx2 / 499380 RGDID:1564797 Length:253 Species:Rattus norvegicus


Alignment Length:188 Identity:54/188 - (28%)
Similarity:81/188 - (43%) Gaps:47/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SAVSAASAGAIGVDS-----LGNACTQPASGVMPGAGGAGGAGIADLPR---------------- 368
            ||.:||:||. ||.|     ...|.:.|.:..:|.........:|..|.                
  Rat    53 SAAAAAAAGR-GVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRD 116

  Fly   369 ----YPWMT-LTDWMGSPFERVVCGDFNGP------NGCPR--RRGRQTYTRFQTLELEKEFHFN 420
                |||:. ...::|..|:    |:...|      |...|  :|.|..::..|.|.||..|..|
  Rat   117 PSTFYPWLIHRYRYLGHRFQ----GNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKN 177

  Fly   421 HYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMK 478
            ||:....|.::||:|.|||.|:|:||||||.|.|::     ::.|:.   .:.|:|.|
  Rat   178 HYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQ-----KLEEEG---SDSQQKKK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 25/51 (49%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
Emx2NP_001102639.1 Homeobox 159..212 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.