DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001094257.1 Gene:Hoxb4 / 497988 RGDID:1560113 Length:250 Species:Rattus norvegicus


Alignment Length:117 Identity:58/117 - (49%)
Similarity:66/117 - (56%) Gaps:32/117 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 NACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPN--GCPRRRGRQT 404
            :||.:|..                   ||||          .:|.....| ||  |...:|.|..
  Rat   133 SACKEPVV-------------------YPWM----------RKVHVSTVN-PNYAGGEPKRSRTA 167

  Fly   405 YTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            |||.|.||||||||:|.|||||||:||||||||:||||||||||||||.||:
  Rat   168 YTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 43/51 (84%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxb4NP_001094257.1 Homeobox 164..218 CDD:395001 43/53 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.