DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_006247294.1 Gene:Hoxb6 / 497986 RGDID:1562142 Length:224 Species:Rattus norvegicus


Alignment Length:233 Identity:93/233 - (39%)
Similarity:113/233 - (48%) Gaps:47/233 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDK--SCSRYTDTVMNSYQSMSV----PASA 309
            ||.:|.|       :.::|:.:|...|       :||  :.|.|.......|...:.    ||.|
  Rat    29 SSGYADP-------LRHYPAPYGPGPG-------QDKGFAASSYYPPAGGGYGRAAPCDYGPAPA 79

  Fly   310 SAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWM-T 373
                  ||:...||.:...|........:...:.|.|..|     ..|.........|.|||| .
  Rat    80 ------FYREKDAACALSGADEPPPFHPEPRKSDCAQDKS-----VFGETEEQKCSTPVYPWMQR 133

  Fly   374 LTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLT 438
            :.....|.|         ||:|   |||||||||:||||||||||:|.|||||||||||||||||
  Rat   134 MNSCNSSSF---------GPSG---RRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLT 186

  Fly   439 ERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476
            ||||||||||||||.|||.:.:......|   .||:||
  Rat   187 ERQIKIWFQNRRMKWKKESKLLSASQLSA---EEEEEK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 48/51 (94%)
Abdominal-A 456..478 CDD:289192 6/21 (29%)
Hoxb6XP_006247294.1 Homeobox 150..203 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.