DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Tlx3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:369 Identity:88/369 - (23%)
Similarity:126/369 - (34%) Gaps:135/369 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKM 261
            :|..|:.:|.|....|..:.:.||.....||.|......||                        
  Rat     2 EAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGAS------------------------ 42

  Fly   262 YPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASA 326
              |:...|   ||..|.|                    |.|:  |||.:...|.| :.|.:.:..
  Rat    43 --YLGGPP---GGRPGAA--------------------YPSL--PASFAGLGAPF-EDAGSYSVN 79

  Fly   327 VSAASAGAIGVDS---LGNACTQPASGVMPG------AGGAGGAGIADLPRYPWM---------- 372
            :|.|.||.|.|.:   |..|...|....:|.      ....||.      .:|||          
  Rat    80 LSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGL------NFPWMESSRRFVKDR 138

  Fly   373 ----------TLTDWMGSPFERVVCGDFNGPNGCP--RRRGRQTYTRFQTLELEKEFHFNHYLTR 425
                      |:|..:|.|::          |..|  |::.|.:::|.|..||||.||...||..
  Rat   139 FTAAAALTPFTVTRRIGHPYQ----------NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLAS 193

  Fly   426 RRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNK 490
            ..|..:|.:|.:|:.|:|.||||||.|.:             |:..||:|               
  Rat   194 AERAALAKSLKMTDAQVKTWFQNRRTKWR-------------RQTAEERE--------------- 230

  Fly   491 QVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSIIAHNPGHLHHS 534
                 .::||..:...|.||...|:...|.   |..:|..||:|
  Rat   231 -----AERQQASRLMLQLQHDAFQKSLNDS---IQPDPLCLHNS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.