DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and lum

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001011006.1 Gene:lum / 496415 XenbaseID:XB-GENE-1004934 Length:353 Species:Xenopus tropicalis


Alignment Length:43 Identity:10/43 - (23%)
Similarity:18/43 - (41%) Gaps:16/43 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 GGLGGN----------------LGMMSALDKSNHDLLKAVSKV 588
            ||:.||                ||.:.|:::...:|...|:|:
 Frog   259 GGVPGNAFNISSLVELDLSFNELGSIPAVNEGLENLYLQVNKI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
lumNP_001011006.1 PRK15370 <56..>256 CDD:185268
leucine-rich repeat 81..104 CDD:275380
leucine-rich repeat 105..130 CDD:275380
leucine-rich repeat 131..151 CDD:275380
leucine-rich repeat 152..175 CDD:275380
leucine-rich repeat 176..200 CDD:275380
leucine-rich repeat 201..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
PLN03150 <235..>307 CDD:178695 10/43 (23%)
leucine-rich repeat 246..270 CDD:275380 4/10 (40%)
leucine-rich repeat 271..294 CDD:275380 3/22 (14%)
leucine-rich repeat 295..320 CDD:275380 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.